DPCstruct | MC48228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 7.89 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 52.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2T0T6 | 7-77 | SISYSEICKYETSMTMNTLSEVQDNGFVQFVFDNADHNTRTVDRHGTFHVMGGVQCVTPVSAVQTCSCIHL |
| A0A2G3APT6 | 25-116 | YGSKRLIDVLESLSVCSSYHEAKKFEVSSIMRTPLEIDQNSFSQFIFDNADFNTQTIDGLQTFHAMGGVQCITPRKAIPPDQIIERI… |
| A0A4Y2PZG6 | 2-76 | None |
| A0A4Y2G6Z1 | 174-251 | None |
| A0A4Y2UKB0 | 7-77 | None |
| A0A4Y2D786 | 58-138 | None |
| A0A4Y2RXA8 | 41-128 | None |
| A0A4Y2KV62 | 41-128 | None |
| A0A821X8S9 | 29-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.