DPCstruct | MC48221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 74 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F7RFB6 | 128-198 | MAPNVTADDSKNIIIGATEYMEYSVKGTNEWLTYNPGNPPKFDGDKIVYVRHKGEMNLEPGLTQLLRFSAN |
| A0A2H3MIX5 | 16-84 | LDVIADDKKNILVGATEYMEYSIEGTNECHTYNAGNPPKFEGDQTVYVRHKGERNLHPGLTRIVHFSAN |
| A0A1I0Y6L3 | 587-659 | None |
| A0A7X6XB20 | 315-388 | None |
| A0A7X5KPN2 | 138-211 | None |
| E1NP77 | 400-482 | None |
| A0A7Z7G4C0 | 70-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.