DPCstruct | MC4822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 97 ± 20 aa |
| Standard deviation of domain lengths | 19.63 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G6Y6H0 | 44-153 | MPAGQGGMMPGGQGGMMNMPMDTANMSESSKAYMDAMKQMDGPMMQGIKAGDPDVAFVQAMIPHHQAAIDMARAVLQFGKDDQVKVW… |
| A0A7X5JC62 | 198-278 | SIEANRMVNMNMHQNMAVEFTGSADIDFMTGMIPHHEGAVAMAEVVLEHGKDKRVKDLARGIINAQTSEITTMKKWLSRLK |
| A0A5P2QQV2 | 69-189 | None |
| A0A841GGP7 | 125-231 | None |
| A0A3S1QKP5 | 114-204 | None |
| A0A2W6TTN4 | 1-69 | None |
| A0A357X6H6 | 26-108 | None |
| A0A0Q4Y762 | 1-98 | None |
| A0A543LYK5 | 23-107 | None |
| D7A4M1 | 86-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.