DPCstruct | MC48216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 114 ± 11 aa |
| Standard deviation of domain lengths | 11.48 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 42.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H5K478 | 14-124 | VERDVWLTDEFGASHQGAVDVLLADGTVPGPVYFDTASGTGGRSVLQWSVYDGRHRRPRAAGLCAVCSCGWAGPQHALDWDLIGGYE… |
| A0A3D9LQB9 | 1-111 | MWEPDGAEGHVGKVGVLLQDGTVPGPVYIDIGSSGHVPSFTDWWFYTGEGRAPLAERMRASCACGWYGETTYPIDWIQVSHREPHLY… |
| A0A1H5K0E2 | 55-187 | None |
| A0A0F4J9K0 | 1-122 | None |
| A0A397RJQ7 | 6-107 | None |
| A0A4S2V5M8 | 7-120 | None |
| A0A1C4QPE6 | 87-209 | None |
| A0A0N1G1Z6 | 1-99 | None |
| D3U9X5 | 51-148 | None |
| A0A5P2A290 | 211-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.