DPCstruct | MC48206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 14.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 56.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1F7Q2 | 3-99 | MDKSRTPNEAALDFVSKFNKIYFQTFTHHLSSFVQDGFLKDLFEKNPSVPKDKAQLLIQKFGEIANPANFSSQAQATNIQPTTLSLI… |
| A0A2H5R4J1 | 1-133 | MSMDKSRTSNEEALDFISKFNEIYFQTFTHHLSSFVQDGFLKDLFEKNPSVPKDKAQILIDRFGDSANPANFTSQAQATNIQPTTLS… |
| A0A2I1H505 | 15-144 | None |
| A0A2N0RQH6 | 1-130 | None |
| A0A2H5U0D9 | 1-133 | None |
| A0A372R515 | 1-137 | None |
| A0A372QSV2 | 9-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.