DPCstruct | MC48203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 110 |
|---|---|
| Mean domain length (aa) | 66 ± 9 aa |
| Standard deviation of domain lengths | 9.23 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372QLA9 | 5-75 | LCKHTLDDAKQIALTRDGKYLSTEYKNNKSPLLWICKNQHKWYAKFDNTVNKCSWCPYCSKYKRENLCRQI |
| R6E997 | 320-375 | LTLDDLKKAAEFRGGECLAEEVPDIYTPIKWKCADGHEFMMSVNAVLHGGHWCPEC |
| A0A158BF73 | 266-348 | None |
| A0A2N0QR13 | 207-279 | None |
| A0A2N0QTQ9 | 6-67 | None |
| A0A2A9KJR9 | 123-176 | None |
| A0A397S9G5 | 27-98 | None |
| A0A1E4ZY97 | 1-68 | None |
| A0A1G8NKN5 | 283-362 | None |
| A0A4R1IAN3 | 87-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.