DPCstruct | MC48200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 333 ± 69 aa |
| Standard deviation of domain lengths | 68.82 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 73.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 31.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5SUM8 | 38-271 | EREVSAAFKKFWDALFKFEDTILMYNNVTHKELLNLLSMDNREREDTIHKGKCRNIVNRIIESIRYRQQPKMKEKGLRIIIVVIVRD… |
| A0A372QEC6 | 3-313 | INEGEKPEMFKKFWKVFQKVILEAMSYNKNTIEKWLEYVKLTRKEGGEIYPSSEKKRSKELIKIREKGEKLIYVIIASIRYRNKPDY… |
| A0A2N0QPM1 | 1-207 | None |
| A0A015KG84 | 61-377 | None |
| A0A2H5SC83 | 5-335 | None |
| A0A2Z6RWA8 | 1-291 | None |
| A0A372QA88 | 1-418 | None |
| A0A372Q2F0 | 4-410 | None |
| A0A2H5RI01 | 1-407 | None |
| A0A2H5UHN7 | 4-420 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.