DPCstruct | MC4820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 141 ± 12 aa |
| Standard deviation of domain lengths | 11.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 15.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A4PX62 | 26-159 | KLRDNRMRAQAAAKPPPSDPAEIFRRKVESQFVPILDELASKYVAKGIVIEWDLSSMLTGGREMIIEFALRPVRWRLRGTLARDVVA… |
| A0A4Q2U4K7 | 1-159 | MRDELRDRLRSTFAAGRAPGETGSAPGAAPSPGDAFLRDFRVKAERVVVPAMTEVGRVLEGHGRFFSIERIAERTTPRGVLVPTSVQ… |
| A0A4U1H9Y5 | 1-146 | None |
| J6J3A3 | 1-141 | None |
| A0A533UNX3 | 16-146 | None |
| A0A2U8VN56 | 29-179 | None |
| A0A437QY95 | 3-154 | None |
| A0A2R8CIX8 | 1-157 | None |
| A0A538HCE9 | 17-150 | None |
| A0A6C1SKA9 | 10-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.