DPCstruct | MC482
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 157 ± 18 aa |
| Standard deviation of domain lengths | 17.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4H344 | 1-137 | MPGHKTHLAAELACLPLCLGAGYGLGLREELLPLGLGYLAGSLFLSPDLDLYHSRPARRWRLFRALWWPYTRLFRHRGLSHHPLLGP… |
| A0A345IMT5 | 1-152 | MQGSEHTRVHLLCTVAIAGGMMLTGREDAAYGISLGMVIGTLWITPDLDLTYNDARRNWGPLRWIWNPYASARRHRGINHTYVIGPI… |
| A0A0E3P036 | 49-202 | None |
| A0A3D4GVX7 | 1-162 | None |
| A0A5C8AXS6 | 1-157 | None |
| A0A4P5VFN3 | 1-182 | None |
| A0A5J6XMM6 | 62-225 | None |
| A0A7V3UG02 | 1-169 | None |
| A0A7C9TXK2 | 1-177 | None |
| A0A7V3HKH3 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.