DPCstruct | MC48199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 486 ± 55 aa |
| Standard deviation of domain lengths | 55.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 32.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372QE77 | 28-493 | VSRLHLCYTQGINIINLFYMENGLKITTKKFDELKQIYLLEFIDSDKKLFIIGECLKGNIVSIIWDIYNTAKRKQIELDNFPINKFK… |
| A0A2P4PZ89 | 174-660 | LLSRSIENDYFLIEDYKDRVQVVEMYNLRTDKLEMVFHQRAESAVTAFGHGNPAVAISKHNALLAYCRGANSITIYLIENSLEISTQ… |
| A0A2I1ES84 | 1-393 | None |
| A0A2I1FAK3 | 20-542 | None |
| A0A2Z6RAK9 | 4-544 | None |
| A0A2N1N988 | 1-487 | None |
| A0A015N1U4 | 2-501 | None |
| A0A2N0S363 | 406-888 | None |
| A0A015KRX6 | 27-551 | None |
| U9SSB2 | 3-461 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.