DPCstruct | MC48198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 165 ± 16 aa |
| Standard deviation of domain lengths | 16.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 36.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372Q9E0 | 3-156 | VIKVICEHYVFNKDDELILDDKTEENVLGNKELLEYGYIIEDDELDIRFAKFEEWLDEIESVTIKDKGYGTMRYFKEILHLEENIAK… |
| A0A2I1HX91 | 1-150 | MSVIKMICEHYIFDEEDNLLVEEKETGEKLLGNKELLTYRYIIEDDELDRRFIELEEWLKEEKIVTIEFITQNTMKYFKKILHMEES… |
| A0A2N0QPM1 | 55-199 | None |
| A0A2N0R1J9 | 18-187 | None |
| A0A015KG84 | 102-269 | None |
| A0A397SBY7 | 1-184 | None |
| A0A372Q2F0 | 131-299 | None |
| A0A372Q3K6 | 35-161 | None |
| A0A372Q5K0 | 19-187 | None |
| A0A372QEC6 | 96-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.