DPCstruct | MC48193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 105 ± 19 aa |
| Standard deviation of domain lengths | 19.23 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015HZV3 | 1-92 | MEWEKINLQAVQDILQEHNLDGLENFRVWAMEKNNFFHVGNTIISLVEQNKIMEKYTTLNDNFTKRLKDENRYKNDNEIGEKRVALE… |
| A0A372Q5X1 | 1-106 | MEWENINREALRLIKNEHGLNEPGQVKGWAMKTNNFMMLSQRIISMAKQSDIMREYTTLNDDFKKRLKDEDRKTDEKEIGEKRPILE… |
| A0A2P4PUD3 | 215-319 | None |
| A0A2I1GVN7 | 111-258 | None |
| A0A2I1GII7 | 180-279 | None |
| A0A2I1GC84 | 97-244 | None |
| U9T163 | 113-203 | None |
| U9SRY4 | 37-140 | None |
| A0A2H5SKL4 | 318-392 | None |
| A0A372QSJ9 | 63-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.