DPCstruct | MC48190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 14.01 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 44.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015JYR4 | 1-96 | MHRFWLNSRNIQESRITGSELFPGSMLKPVFENVRLSSSMLDLMAEYYSATYETLNFRKPFGEGEADSIVIRVSIDKFGRCQIGSEV… |
| A0A2N0NN25 | 3-126 | ALPLVQSRLTTGSLAAYDGFDFNELYHFMQNFHQNIDNTITTGSEEFPGEMLTPRNRVSLPNATYELLVKYYNDIYDWNFTSIADLA… |
| A0A015L2V3 | 74-211 | None |
| A0A015KX05 | 1-120 | None |
| A0A397IZF2 | 185-314 | None |
| A0A2H5T1B2 | 220-329 | None |
| A0A2H5SNM7 | 152-270 | None |
| A0A2H5SHY4 | 1-99 | None |
| A0A397TQG8 | 45-150 | None |
| A0A2H5S608 | 4-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.