DPCstruct | MC48180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 276 ± 54 aa |
| Standard deviation of domain lengths | 54.23 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2V3G9 | 18-250 | SCPGVDAPCSDQGTCLTMAALAELGNENGVLQGYTYGNTPNHPATWDFDKIQGCDCDTGYTGYDCSRRVCPFGDDPLTLNQANEVQA… |
| A0A662WPM2 | 26-247 | SCPSSCSGSGRCVSMRDAATLQDDRNFFVSTTYTLWDADKSVGCQCDPGFTGFDCSLRECPTGDDPLTTGQANEVQLLRCTCTSCTG… |
| D0N517 | 427-638 | None |
| A0A2P4YQC4 | 96-320 | None |
| A0A1V9Z7L5 | 5-226 | None |
| A0A7S2RYU0 | 471-804 | None |
| A0A6G0X4F1 | 172-508 | None |
| A0A1V9YUC9 | 641-973 | None |
| A0A1V9YVD8 | 482-697 | None |
| D8LUB1 | 325-633 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.