DPCstruct | MC4818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 132 ± 27 aa |
| Standard deviation of domain lengths | 27.29 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 18.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A9AUH1 | 3-93 | RLVSEWRRATVYVPRWRSVVRLADLAKRDRGREYRPRLRRVRSEGWRDRVRVRLIPAQSPEAWELRREALAHSFGARSCRVRVLKPR… |
| A0A1H4U218 | 112-251 | MPVTEPVPAGVDGDQARSAARTLVATEQLRTNFARTFPILRNPVDFASTLEIAGLAGIVVQTVPTPAGNQELTTVRVPPLLRVGYTA… |
| A0A2A8CZK4 | 2-78 | None |
| A0A7W5V2B5 | 41-196 | None |
| A0A8B3CZP9 | 20-125 | None |
| W9D0N1 | 40-209 | None |
| A0A1V8Q4V5 | 9-123 | None |
| A0A4R4VZE1 | 73-225 | None |
| W9D952 | 63-204 | None |
| A0A2G7C2W1 | 2-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.