DPCstruct | MC48179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 80 ± 4 aa |
| Standard deviation of domain lengths | 3.67 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3GYP9 | 79-158 | YFVQYGRDIEKLDELGLNVKLSLRAWNKRVVPLLKTYAELHGEGEVPVDFVVPSDTPWEKKVTGVRLGLIVALNSQLMSR |
| A0A484EA41 | 49-127 | SGKYFAEVGLNADQLGTFGFRYKLENGPYQDHVAPLIRIYASIYPHAILPEEFIVPPTAPWPQELHGFRIGKIVSWSSH |
| A0A329RSV9 | 348-426 | None |
| M4BKE7 | 1-81 | None |
| A0A6G0QGP3 | 278-349 | None |
| A0A662X3Z9 | 742-824 | None |
| A0A6A3SYM9 | 1-87 | None |
| G4ZDQ1 | 33-109 | None |
| A0A6A3M0N5 | 234-311 | None |
| A0A225WNG4 | 155-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.