DPCstruct | MC48178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 168 ± 11 aa |
| Standard deviation of domain lengths | 10.90 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 54.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19122 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4TMM9 | 9-179 | EINKYKKFKKVDGAAYRKVNAFLRKRTYITAREWALARLCTDFRTSGGAEMTFIGQHLPELVPFMEDTYTPQAVNQARNAFKKKVRK… |
| M0DV96 | 7-178 | TGGDADGVDDQLPDLDEPGKYERFTRIDSVEYDVANEFLREYTTITAREWAIACLCRDFETETGVRMTFIGENLPELVPFMTDTYSP… |
| A0A424YXV7 | 1-144 | None |
| A0A1Q6DWZ4 | 3-176 | None |
| A0A498GBN5 | 61-243 | None |
| J1L3Y6 | 1-169 | None |
| A0A7D5GNR5 | 35-203 | None |
| A0A2R6DBS8 | 46-222 | None |
| A0A1Q1FNY8 | 56-210 | None |
| A0A1I6MBU4 | 343-505 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.