DPCstruct | MC4817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 117 ± 19 aa |
| Standard deviation of domain lengths | 19.03 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X4FP76 | 79-178 | LDPIPLLLQANDWTHIARGVSQRAELLNLVLKDIYGPQTLIREGLLPFELIYNHAGFLRSCKDIFLPAEHQLRVYAANLARGPDGQM… |
| A0A399VER8 | 93-214 | IYELEKLNETAKAHFLYQGITFAVYGEKSGIDRTIPFDLIPRVIAKQQWNKIEAGCTQRIKALNLFLADIYHEQNILREGFIPELPV… |
| A0A7W3UG77 | 1-156 | None |
| A0A7K0F6H2 | 1-94 | None |
| A0A388QV50 | 5-106 | None |
| X8F632 | 2-108 | None |
| E2CP30 | 37-155 | None |
| A0A4R5VBE4 | 669-776 | None |
| A0A1N7LK32 | 1-177 | None |
| A0A6G3VJA2 | 159-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.