DPCstruct | MC48162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 70 ± 8 aa |
| Standard deviation of domain lengths | 8.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 95.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 57.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376X152 | 1-67 | MAIEVPATQVSVSDTVSTYLFNSQLLSRDDGSMMLVLPQECREHAGVWGYLNELLAADNPISELKVF |
| A0A0A2VZN2 | 238-304 | RALEVPDELVSVADAVSTYLFNSQLLSRADGGMTLVLPEESRQHPGVWRYLNQLLEADNPVRELEVF |
| A0A6N8K9B8 | 16-96 | None |
| A0A377LG45 | 59-125 | None |
| A0A485D6S7 | 29-111 | None |
| A0A484ZB52 | 1-56 | None |
| A0A7H4ZJ93 | 4-68 | None |
| N9RPA2 | 38-105 | None |
| A0A447XET1 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.