DPCstruct | MC4816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 108 ± 15 aa |
| Standard deviation of domain lengths | 15.36 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 31.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A399VCJ0 | 1-116 | MNKYGRLAHDHWEKFLPTRFAEIPAPSREEFFSTLGQQVQDQVSTLSEALERADSPNPEYLAEVGRLNMAKLMAEEKILAELVYLPP… |
| A0A7Y9KJG4 | 1-89 | MNQHGRHVERHWRAHRPASTAHLQDREAFFTAAGEEIQNRIAQLTPQLAGPDLPGEDSLAKVARLSNARARATEMALSDSGLFTTSE… |
| A0A4V6Q5X0 | 33-143 | None |
| A0A1V1W5F8 | 1-115 | None |
| A0A419HA84 | 1-121 | None |
| A0A7G7MGT0 | 4-149 | None |
| A0A7U0U781 | 19-118 | None |
| A0A849DP23 | 1-93 | None |
| A0A560W605 | 7-103 | None |
| K7SJ30 | 17-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.