DPCstruct | MC48157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 103 ± 13 aa |
| Standard deviation of domain lengths | 13.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12940 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2A786 | 8-96 | ILFHGKDIIYSCILPIAQLLKEAQEARNKQNRKFRELFPRKTSIIDKNKDLINRLLLTSDPFIANLRALPKTKRGKISNEVRELLER… |
| A0A6P7FPQ5 | 199-295 | MPSSVHKILLHGAIVIKEAILPIGQLSEEAQESRNKDLKSFREKHTRKISRISGNQDLLNRLLITSDPVISSLRQYPLRKSSNISSE… |
| A0A4C1UMK9 | 162-283 | None |
| A0A2W1BK67 | 341-460 | None |
| A0A0J7K2J2 | 99-186 | None |
| A0A4C1TTD5 | 59-152 | None |
| A0A0J7KQY6 | 174-297 | None |
| A0A0J7KFV0 | 108-234 | None |
| A0A815MY95 | 129-232 | None |
| A0A6G0Y8P6 | 238-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.