DPCstruct | MC48155
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 3.84 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05485 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2A4V6 | 44-113 | DKIMSKRYKYCIVPECAKTTITAPDTLFMNVPNNDVLRKKWCKAMKRDGKVNPKFSASSVLHVCGNHFDV |
| A0A5E4QTZ9 | 398-467 | IATVKAKKPTYRYCVVPKCKNTMKRTPNKIFFLVPRDVERRKRWCRAMRRGDLSPRTGVYCCQDHFDIEN |
| A0A2G3AQV3 | 1-67 | None |
| A0A7I0ZJI9 | 68-131 | None |
| A0A835GM14 | 29-93 | None |
| A0A835G6T6 | 2-66 | None |
| J9KTE6 | 3-70 | None |
| A0A5B7IBQ8 | 3-65 | None |
| A0A6J2KCR6 | 4-65 | None |
| A0A4Y2TXD9 | 514-577 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.