DPCstruct | MC4815
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 8.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0ZL55 | 3-74 | EYYLLAEKLRSGGFQEDSSENAPICRWKAGGLLLDVMPTNPELLGFGSEWYKEAFEAATLQSLPSGKRIYMI |
| A0A076HXG2 | 2-88 | TYDVDCIVEIAPRAAYHVLEEELRALGLINDIASGVLCRGTYQGMTVDVMPTEPEILGFSNPWYPAGFAHATIYRLPNGLEIRILSV |
| A0A1Q5PDE4 | 3-88 | None |
| A0A1X1QNN6 | 28-112 | None |
| A0A6G7C3V7 | 2-78 | None |
| A0A6I1L7W0 | 44-127 | None |
| A0A1F7MUH8 | 39-138 | None |
| A0A258YV86 | 9-98 | None |
| A0A0D9SHN2 | 251-339 | None |
| A0A7V9S2U8 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.