DPCstruct | MC48149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 4.05 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 57.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6N649 | 3-62 | FFSRTTYDDNVITNTIEIYASPSGAIHFTESNNDCGIRNFDMEKFQLSKHFRFPWPVNVN |
| A0A453QV85 | 170-236 | LGERDVKFCTRTTLSDNAITNAMDIHRSTSGSLRITVSNNDSGVREFDMERFQLLNHFRFNWPVNVS |
| A0A3Q0EPQ2 | 53-111 | None |
| A0A453REC7 | 18-77 | None |
| A0A453B1N0 | 267-333 | None |
| A0A453B1N3 | 68-133 | None |
| A0A5P1FTR0 | 264-320 | None |
| A0A453B1K5 | 68-133 | None |
| A0A1D6HIM5 | 125-181 | None |
| M1BY96 | 219-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.