DPCstruct | MC48144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 119 ± 16 aa |
| Standard deviation of domain lengths | 15.84 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 57.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2B2P3 | 19-140 | SFAKLLTIPEQDDWVYSDGKSTSCIAFVLEMYKEAGLFGPLASSIQVTEFTIKDAYSLKFFENNTNRLPMWCNADDTVKLPFCQILG… |
| B4G0B4 | 241-363 | ITFDKLLSVPENDSWVYEDGQSASCVAFVLMMYKEAGLFDPITSSIEVTEFTIKDAYILNFFEDNSTRLPEWCNKDDDVKLPFCQIK… |
| A0A813A273 | 770-899 | None |
| A0A4S4DKG0 | 277-376 | None |
| A0A0D3CRI2 | 1-82 | None |
| M7YRX8 | 370-493 | None |
| A0A830CIR2 | 265-386 | None |
| A0A2I0JIX2 | 68-189 | None |
| A0A2I0KJJ0 | 95-216 | None |
| A0A7S3S6X4 | 12-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.