DPCstruct | MC48133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 294 ± 35 aa |
| Standard deviation of domain lengths | 35.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A239PN38 | 304-578 | VAFNLSEVNDWSAEQPFLDVFKTARPWIGHLPGQWGGFDAPKLHDAGYLDEDGWPLMIPPEVTHLSTLILSDLNEKMISMAGRYVLR… |
| A0A814SHR1 | 13-262 | IANISAYIAIGGSPSSPWDRDATFDPTTGWPTRDFGMVLSTAAIDMGGTYLLNAQGNAQVAVYGDSSAGRIANKMYNASTNTLSASV… |
| A0A5C7PZW6 | 5-288 | None |
| W4L9F4 | 36-294 | None |
| A0A1U7HLZ9 | 107-422 | None |
| A0A7Y4WH51 | 25-348 | None |
| A0A7X4YPS5 | 277-620 | None |
| K9YXE2 | 64-348 | None |
| A0A418RNI9 | 117-445 | None |
| A0A3D9HRU4 | 1-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.