DPCstruct | MC4813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 112 ± 10 aa |
| Standard deviation of domain lengths | 10.14 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7DPM0 | 456-561 | RDFPQPLWLGDAPLAGRTILLHAEQGLGDTLQFCRYVERVKALGATVVLEVQRPVVNLMSTVRGADVVVARGDPLPPFDCHCPLLSL… |
| K9T6K0 | 2-116 | WDGSDLNGKTILLHNGDDGFGDIIQLIRYAPLVAQKGGRVIFACPKPLFRLFGCISGIDRLVILEDKLPDTDVYLPLLSLLYYLGTT… |
| A0A328ALR3 | 75-166 | None |
| A0A483A883 | 75-176 | None |
| A0A120DWU0 | 13-115 | None |
| R5DSD6 | 210-331 | None |
| A0A2E3ZZB4 | 408-519 | None |
| A0A7X6HSA1 | 989-1112 | None |
| A0A2M8E6X3 | 107-228 | None |
| A0A365VML4 | 17-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.