DPCstruct | MC48124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 155 ± 11 aa |
| Standard deviation of domain lengths | 10.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E2C922 | 150-299 | PPARFADRNANLRLVGTGAPASQRVEDATAAGGQARRLGHGKPSDHRFPFVMKVHDDVAARDFGTRTLNTGDIPQDEAWHWHLISTA… |
| A0A7X9AC53 | 1-151 | MPEQFKKRNFYDFSTADFRNCETQNISLVKDSDSETGEAFRVDVNAHHLYHPPFAVGLYDADMKKDMFFNTVRHSKEPGYHFYKIAT… |
| A0A3D1ULY3 | 25-176 | None |
| A0A7X6U9T6 | 1-134 | None |
| A0A7X8UMT5 | 89-256 | None |
| A0A7X8J7R8 | 617-775 | None |
| A0A1V5VD36 | 587-752 | None |
| A0A1V5VBW1 | 620-766 | None |
| A0A7X9AZR4 | 636-783 | None |
| A0A2M7A448 | 481-650 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.