DPCstruct | MC48119
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 111 ± 10 aa |
| Standard deviation of domain lengths | 9.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.24 |
| Pfam Score | 86.61 |
| Assigned Pfam label(s) | CL0205- PF03722 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N7ZAN8 | 1-114 | MYKDGGVAVRHLMDELTHGRLLEKKHWAVATNKRHLEEAIMLFEVFMQCKDWNCVASNGAYFRERVNEEEFIYAAYHAIKHSPLTQH… |
| T1H4B2 | 2-109 | DFCMEIGRYDEFSLFIPNHTRIAGALIQIFIEQETVDNLLSVAARIRDKINPMLFNYALSVAILHRPDTKLLPIPLLANIFPEKFLH… |
| T1GIW3 | 33-133 | None |
| A0A6H5GDL4 | 3-118 | None |
| A0A7R9E732 | 89-192 | None |
| A0A7R9AI55 | 3-101 | None |
| A0A3B0J5Q8 | 2-122 | None |
| A0A182U2Y8 | 73-175 | None |
| A0A4C1UZE8 | 92-210 | None |
| B4IGG3 | 75-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.