DPCstruct | MC48117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 149 ± 17 aa |
| Standard deviation of domain lengths | 16.64 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W8CGF9 | 1-135 | MAHIGTWSLNDLNLKDLIKIAVKPQTLQKTVVAIVLDLSRPWTIKSSLEQWLSALEGQLLEQINQLAPETRNELYGAIKQHILAYED… |
| T1H3M4 | 1-167 | MTRLGVWILDGDPGHTNLLRYALNETNYAHTLIILTVSMTTPWSWLEQMNHWIKILDDHVKSLKLTPEEREEAQKHLVTRWQSYCEV… |
| A0A015JVG3 | 41-213 | None |
| A0A183KNG9 | 1-137 | None |
| A0A2I0TGZ3 | 4-144 | None |
| A0A4Z2J616 | 36-152 | None |
| L9K275 | 669-822 | None |
| A0A433PG96 | 109-253 | None |
| A0A183CP80 | 12-180 | None |
| L5L3G9 | 240-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.