DPCstruct | MC48115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 224 ± 46 aa |
| Standard deviation of domain lengths | 46.49 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1H2A8 | 1-174 | CQDHKLITEPTKVPIVNRNQNCQPGLEHLKYGRFLRVETHCNGGASVVHMYQDEIDSLSPEEMDELVDEFFSVCFAEDENGYAQHVM… |
| A0A1Y3AP81 | 5-160 | LSLSLMTPRLPMPAAELQNLRYGKYFRIEQCPNGYAKVLHLYWDEIAHLDRQQKLELAAEFMKESFREVRPNVSAYVISIVHNAAYY… |
| A0A819VTW9 | 411-599 | None |
| A0A817U1G0 | 738-989 | None |
| A0A452UE17 | 73-328 | None |
| A0A2C9JZT5 | 609-870 | None |
| A0A3Q1EXD6 | 60-301 | None |
| A0A0V0Y8I0 | 506-671 | None |
| A0A2H1BR69 | 1-264 | None |
| A8E4X6 | 230-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.