DPCstruct | MC48114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 149 ± 18 aa |
| Standard deviation of domain lengths | 18.01 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1H1I1 | 1-147 | MQNILLKSLLKVGTQYRTVAFDKAFPASFLQPLLKMARTPHDPTRIIVMQIFQALLDRHQNQGVLTNITTQPYSAMSQETPSRSDIL… |
| B4NSB5 | 98-223 | YSTVSFEKAFPASFLQPLLKMARAPHNPTRMVVMQILQALLDRHQNEQVLSSVSVKPYPALSQEPPSRSDIIFTHKYGANIMQALID… |
| U4U5Y4 | 1-146 | None |
| A0A315UNN2 | 3-195 | None |
| A0A402E9M0 | 8-149 | None |
| A0A183AJH0 | 121-267 | None |
| A0A6J1UH91 | 393-537 | None |
| A0A553QLW1 | 105-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.