DPCstruct | MC48113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 190 ± 16 aa |
| Standard deviation of domain lengths | 15.93 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12394 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1H1H6 | 1-199 | LVDSRHLKESIERAEFSLHLELWFSEKSTLSRNLSLASSRTLQLNFLPGRGLHYHLPVLFDYFHLSSVSIGIHASLVALHQPYINAP… |
| A0A3P9QIR6 | 95-276 | LDEKKVEESLNEMDFQLCLDLYFTDGDYTPEDPSSLQNISSRVLHLHFSLQRGIHQHINVMFDYFHLSVISVAIHASLVALHQPLIS… |
| A0A2R7WA65 | 118-291 | None |
| A0A817KVY5 | 101-263 | None |
| A0A2G8L7U6 | 34-236 | None |
| A0A0R3SER6 | 1-186 | None |
| A0A5K3EZN6 | 1-195 | None |
| A0A2J7R9T4 | 5-182 | None |
| A0A5K4FC20 | 121-303 | None |
| A0A5E4BR35 | 303-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.