DPCstruct | MC48111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 133 ± 17 aa |
| Standard deviation of domain lengths | 17.33 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.73 |
| Pfam Score | 99.31 |
| Assigned Pfam label(s) | CL0010- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1H0B0 | 11-129 | FDIITKRKIHCTVCRGHLGCAPGKEDNIKMHPVLRVMQCSDCHEFYSSGEFSRGEDGSELYCRWCGQGGQVYCCSSCPYVFCKSCIV… |
| B0X8C4 | 86-213 | PNVNKIAERKVHCTSCYMHIGTAPISEAVIRMHPVLRVTHCRNCHTFYNSGEFDKGEDGSELYCRWCGQGGEVYCCSKCPYVFCKKC… |
| A0A7E5X444 | 45-182 | None |
| A0A2Y9QA88 | 5-131 | None |
| A0A6I8T2T0 | 234-367 | None |
| A0A6P8HD78 | 156-279 | None |
| A0A834XMX8 | 400-545 | None |
| A0A182FVT4 | 34-152 | None |
| A0A1I8IPI0 | 72-215 | None |
| A0A1I8IHU3 | 71-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.