DPCstruct | MC48110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 61 ± 2 aa |
| Standard deviation of domain lengths | 2.30 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 62.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0541 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1JXT8 | 877-937 | SIKGFMHMKIVKQSDGKFVLGVFSKPFSSIPEMVKHYSINKLPIRGAEHMSLLYPVIDQLL |
| T1GZH4 | 1-56 | MHMRIQRNDNGQYILGQFSRPFDSIPEMIRHFCLNRLPVRGAEHMCLIEPVIVQLL |
| A0A556U176 | 141-204 | None |
| H3BWP2 | 146-206 | None |
| A0A3P4PUB3 | 50-110 | None |
| A0A0V0Y653 | 339-394 | None |
| A0A2P4SN33 | 7-67 | None |
| A0A3Q0J884 | 587-648 | None |
| A0A401RSH3 | 70-132 | None |
| A0A1V4KE65 | 33-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.