DPCstruct | MC4811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 275 ± 44 aa |
| Standard deviation of domain lengths | 43.65 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 42.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y1RP93 | 20-321 | SGCLKVFYVVFAFGSALCLGALKGLLVGPISALILILGNVAIILGLFPAHVAWTIYTLIKIDRFDAPLKVAILFALPGLLAIWLGLS… |
| A0A3Q7HAA0 | 2-277 | GLVIGPIVTVIISVGNSAVVIGLWPAHFIWTYYCVAKSKRLGWVLKIALLVSLPVPLTLWPIVAIIGSLIGGIGYGFLAPLIATFEA… |
| A0A6D2J8B0 | 402-635 | None |
| A0A2G5EK80 | 9-347 | None |
| A0A067JJI9 | 20-301 | None |
| A0A1D6Q3N5 | 1-245 | None |
| A0A834ZJX4 | 565-907 | None |
| A0A7S2E767 | 142-449 | None |
| A0A287WAV7 | 10-202 | None |
| A0A7S0R630 | 10-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.