DPCstruct | MC48107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 230 ± 23 aa |
| Standard deviation of domain lengths | 23.48 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 23.97 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0630- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1GWQ7 | 10-232 | LHDRSLCGWCSLTSLCLPRTANESIFCVNDQNWNYLTIQAEQCSNCSDYINCKDCLESSECEWWVDDAKCERVGRAALAVKSIDKCP… |
| A0A521UHV4 | 117-335 | TLNCASQTSCASCTAQSTCGWCGLTARCMDGSSTGPLGGATCALGWAWTASACVSVDPCSASTSCGACAGQAGCGWCGASNRCVTAN… |
| A0A1A8QWD6 | 358-599 | None |
| B3S377 | 84-367 | None |
| A0A7R9PEN7 | 2-211 | None |
| A0A401RG24 | 10-237 | None |
| A0A1Y3BLI1 | 287-532 | None |
| A0A6I9YXZ6 | 322-544 | None |
| A0A0A9YIC6 | 357-567 | None |
| A0A0G4F7Y2 | 17-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.