DPCstruct | MC48105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 195 ± 36 aa |
| Standard deviation of domain lengths | 36.05 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1GWU1 | 1-193 | MAPREARTISSYSKFYVACDDYCIVTYTLDEDSKYLRGKPKYSVYYRGKVFLMADEEKTLKFLKTPEPFYQKYLRFKPPPKEYIDWD… |
| A0A821Z470 | 17-173 | EYRDKLYFLLNEEAREKFMRQPEKYWNIRLPNKLPPPKTPIDLLNLPCLGYLEQTIATAIIKSLTATGTFKPKFPFLSIQTSGLIYM… |
| A0A820U0M7 | 151-347 | None |
| A0A7S3G6U1 | 295-485 | None |
| A0A7S3GAZ1 | 1-164 | None |
| A0A183RN48 | 204-424 | None |
| A0A7S2R765 | 864-1063 | None |
| A0A6P8NZK3 | 29-355 | None |
| A0A061J7L9 | 9-137 | None |
| A0A6A3TD25 | 196-422 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.