DPCstruct | MC48104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 110 ± 2 aa |
| Standard deviation of domain lengths | 2.34 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 69.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 61.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1GWA2 | 1-102 | MFITLIRFELSFLQILQDILGSILMVLVTIGYKTKLSALILVALLTILNLYHNAWWTIPSYKPLRDFLKYDFFQTLSVIGGLLMIVS… |
| A0A6G1QI48 | 159-267 | LGGRVLLVLMFMTLLHFDPSFFSILQNMVGTALIILVAIGFKTKLAALTLVVWLLAINVYFNAFWTIPAYKPMHDFLKYDFFQTTSV… |
| A0A5E4AB02 | 116-226 | None |
| A0A177WMY9 | 87-195 | None |
| A0A287D201 | 143-253 | None |
| A0A1A9VLY4 | 84-194 | None |
| A0A811LPH9 | 1-112 | None |
| A0A5E4ABE6 | 131-241 | None |
| A0A7J5YJ79 | 146-256 | None |
| A0A6A4SKH5 | 208-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.