DPCstruct | MC48101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 132 ± 28 aa |
| Standard deviation of domain lengths | 28.06 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7J3I7 | 57-136 | YVRYFVSFVLQFQFHKALCTAAGHTGPLHTCDIYRSKEAGKKLGDMLKLGSSEEWDIALEAITGTKNMSAEPLIEYFQPL |
| T1GU10 | 421-521 | QTSKFVSEVLGYQIYRSLCVKSSQLNGNEKLHNCDFFENKEAGNALKELMVSGSSQSWRQVLSTILQNEHSLDAEALLEYYSPVKEW… |
| A0A7R9A1H9 | 870-971 | None |
| A0A7R8XF70 | 215-361 | None |
| A0A7R8XDL7 | 542-681 | None |
| A0A2G8LP82 | 189-320 | None |
| A0A1A9XCY7 | 2-120 | None |
| A0A1I8IQS2 | 370-483 | None |
| A0A1I8I0X8 | 744-874 | None |
| A0A7E5WN89 | 546-712 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.