DPCstruct | MC4810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 57 ± 6 aa |
| Standard deviation of domain lengths | 6.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 53.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09793 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7KXZ5 | 85-134 | LPIRWDSKDMLVMGEVIVRSPYHSDCVFGGTRAVNDRVKTVLEQVRKKLQ |
| A0A3Q7GU14 | 1-67 | MVVYFREGGARLPVRWDKTVIVVMNEVRVSSPYLPESVAGGTPAANERVRKVLELERKRLQSRNTGQ |
| A0A816P8T2 | 139-194 | None |
| A0A6A5P6D6 | 190-255 | None |
| A0A1Y2FN63 | 217-274 | None |
| A0A6D2HHV5 | 31-93 | None |
| A0A444EES2 | 41-87 | None |
| M4EWV3 | 522-577 | None |
| A0A3N6Q5D9 | 175-233 | None |
| A0A2P2K4D9 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.