DPCstruct | MC48099
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 175 ± 30 aa |
| Standard deviation of domain lengths | 30.25 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1GRH7 | 206-364 | YTVYILDQPYSRGNGKYAVFIVPQGREIEWMFSTPEGRKKVLSSAKHNRLAIVVMHRDQKYESLDDVKNELNDSVRNFAPRGLKDLI… |
| A0A1B0FNL3 | 161-305 | GEDLPRFTLHILDQPPTRGLGRYAAFITPQGREVDWLFATPEGRKKLLASTNYQRLVVVLLHRDQEYKSLDAVKAELADSIKNLAPF… |
| L0AYX4 | 305-480 | None |
| A0A1B0A525 | 119-247 | None |
| A0A4Y7MUD6 | 52-217 | None |
| A0A6A6L830 | 18-215 | None |
| B0EQ41 | 2-150 | None |
| A0A2U1QMC3 | 4-215 | None |
| A0A0N4W9Q2 | 771-913 | None |
| A0A3L6RJA7 | 9-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.