DPCstruct | MC48098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 111 ± 15 aa |
| Standard deviation of domain lengths | 15.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01496 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1GR79 | 1-99 | MMLFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGCFSMYTGIIYNDIFSKSLNIFGTHWKVDRNVTDVLANEYLQLDPATAE… |
| A0A6M2DYS1 | 2-107 | FGDIGHGLIILLFASVLVINEKKLIAKNITDDTWNIFFSGRYIMLLMGIFSMYVGFVYNDIFSVSLNIFGSGWIINYNESFIMNNQE… |
| A0A4W6F9S4 | 254-369 | None |
| A0A820L9Y0 | 101-197 | None |
| A0A821QEU5 | 149-274 | None |
| A0A182F8F2 | 838-947 | None |
| A0A0C2JFI5 | 371-493 | None |
| A0A2H6K6U7 | 412-536 | None |
| A0A1A9V0V1 | 70-163 | None |
| A0A1Y3BIB0 | 64-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.