DPCstruct | MC48095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 123 ± 23 aa |
| Standard deviation of domain lengths | 22.74 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N8Y0X3 | 347-492 | HVWTDKSSIFEELQSLDCFLAELYKHLDSSSNERPDISSLQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFI… |
| T1GNK6 | 17-125 | KIRTSIRDVTHKMDLSYGMMGSLFRSGSRQTFFSSQVVRYADLYAATLLNLIYYPFSYMFRAPAMLLPHESTVAHEQRFIMDAPAFS… |
| A0A016U7Z0 | 122-223 | None |
| A0A6H5IG78 | 997-1144 | None |
| W2SK14 | 102-194 | None |
| A0A3P7GF41 | 146-263 | None |
| A0A0B1TQB3 | 180-319 | None |
| A0A1W0XEM3 | 871-1039 | None |
| A0A6I9Q550 | 4-154 | None |
| A0A016U703 | 35-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.