DPCstruct | MC48094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 171 ± 21 aa |
| Standard deviation of domain lengths | 20.87 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1GMU4 | 20-165 | TERSLLIRKLAFIIFCSENGYYDKYLVEIQEQLTNHLKYSSNLLVESSLLYCFRVLLMKLSAQSMMSLWPIVIAELVQVFLSIEESL… |
| A0A4V1IPG7 | 1-199 | MLRRLSFALFCGAVDQYLPQLPSIQEKLVEVLKVSTGLMHVEVFLCLRVLLVRISTQHLSNLWPTVLTELIRLFGVYLKGQDAEKSE… |
| A0A820DVF4 | 2-159 | None |
| U9SFK6 | 150-321 | None |
| A0A5S6PSF9 | 2204-2359 | None |
| A0A183SWM6 | 125-285 | None |
| R1GI71 | 3-200 | None |
| A0A6A4HWI0 | 266-415 | None |
| A0A0M3I5C4 | 67-206 | None |
| A0A1I8GA66 | 2-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.