DPCstruct | MC48090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 168 ± 8 aa |
| Standard deviation of domain lengths | 7.79 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1GGT4 | 1-160 | MDRYDGNNLEYGVYIPITLKVLQISCKEQVCEVISLWKILNDHNFELIVASLSNNLKTILSTSTFRDLIITRTDICSNLIISVMNSY… |
| W6NE01 | 284-457 | LPKPDVTWNNSTVGKMNVQASSMERQSLIALRKLIESSAEVLSLWSSANSFDLRAISASMDPAMLPTLAGRPFCHLVCDGQHLNGDL… |
| A9SMU5 | 1-170 | None |
| A0A4V6T715 | 71-240 | None |
| A0A1D6PG78 | 290-461 | None |
| A0A835IVH6 | 201-363 | None |
| A0A7C9E5E8 | 138-303 | None |
| A0A7D8V048 | 746-918 | None |
| A0A2P6S475 | 218-377 | None |
| A0A059JD43 | 637-805 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.