DPCstruct | MC4809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 219 |
|---|---|
| Mean domain length (aa) | 194 ± 49 aa |
| Standard deviation of domain lengths | 48.84 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 81.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.41 |
| Pfam Score | 95.61 |
| Assigned Pfam label(s) | PF00118- CL0063- PF02515- CL0056- CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q7G2H9 | 113-290 | RWVGGVEFERIAIATGGRIVPRFQELTPKKHGRVVTIFIRGGNKMMIEETKRRFHDALCVARNLIRNNSIVDGGGSAEIFCPIAVEA… |
| A0A813C4P7 | 3-136 | FIEDVRHAKSVTILVKGPNPHTIAQLKDAVRDGLRAVKNAIEDGAIVPGGGAFEIAAAADLMEFKKSVPGKAKLGVQALADALLIIP… |
| A0A6J0NU16 | 59-254 | None |
| A0A6S7N021 | 85-251 | None |
| A0A1Z5SAH0 | 859-1088 | None |
| A0A835HDH3 | 185-379 | None |
| L9KKW1 | 93-299 | None |
| A0A1V6T0Q3 | 763-965 | None |
| A0A287PM10 | 560-695 | None |
| A0A835AIR4 | 426-565 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.