DPCstruct | MC48087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 155 ± 13 aa |
| Standard deviation of domain lengths | 12.68 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1GFG4 | 1-156 | ILTFLIFRVYKDTELKHIWRVGPVLNNCSATNKLNTSLPTLSNLGECVIDFDIFPMQISLPKSKQNPNIRYTWPIALLQENGNIFIS… |
| A0A0V1H9P4 | 108-270 | MALCNDNTLRMYDAFSCKKPLQIVSLDPSKREIGMSTLNPKYFIGDSAVTFDFGSPLDVKEVEQNGPQYWPIFVVHGCGEIRYVLSD… |
| A0A6H5HM34 | 608-736 | None |
| A0A7N9CY42 | 30-192 | None |
| A0A0V0WM14 | 1-153 | None |
| A0A670JSR5 | 75-221 | None |
| A0A6P6XWM8 | 174-318 | None |
| A0A3P8V6X9 | 74-242 | None |
| A0A0L8GJX1 | 463-608 | None |
| A0A7J8D0M7 | 63-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.