DPCstruct | MC48084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 396 ± 63 aa |
| Standard deviation of domain lengths | 63.03 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1GBX3 | 14-436 | PGLDPYVTFVVGTIFLKYISRNYENEAEKCEVGAKFLKILYSFLKSYEIHPNDFSENKKENSPTGYHSLNRTINPMEVEGLSSVLSI… |
| A0A453NQW5 | 6-299 | PEGDAQALVAYLAVLQKVVENGNPSERRKWFPDIEPLFKLLSYENVPPYLKGALRNSITAFVKVSPQLKDAVWSYLEQYDLPVVTVP… |
| A0A5K3FVW7 | 333-774 | None |
| A0A1A9X212 | 2-451 | None |
| A0A4C1W178 | 15-539 | None |
| K3X5U5 | 3-467 | None |
| A0A822CT89 | 192-579 | None |
| K7KWK9 | 521-872 | None |
| A0A7R9H3I5 | 454-881 | None |
| A0A7R9DEU1 | 46-420 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.