DPCstruct | MC4808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 121 ± 15 aa |
| Standard deviation of domain lengths | 14.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04716 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0VI82 | 89-210 | GRTKLSTDQTGVDVHPSPFNALRLTYNKTLKVLENIPKSTVYYQAVHSQTIKNLGIVTKFIDNLKVDQVEDQIKQAENELEVNLIEH… |
| A0A3M0KAQ8 | 14-127 | AASAAMAGALRKTTGLVGLAVAENPHERLRILYTKILGVLQNIPKDAAYRKYTEQIVNERFDLVKKETDVQKLQDKLNSGQIEEVIV… |
| A0A2U1P4V6 | 1-137 | None |
| A0A2R7W380 | 36-148 | None |
| G0QY52 | 36-164 | None |
| A0A0C9X484 | 1-120 | None |
| D8RH13 | 7-132 | None |
| F0WM77 | 9-113 | None |
| A0A6U5B8T0 | 54-164 | None |
| D3BQF3 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.